The TIGR Gene Indices

BLAST Search for TIGR Unique Gene Indices

This server runs WU-BLAST 2.0.
  • TIGR Unique Gene Indices include Tentative Consensus and Singleton EST sequences and can be searched with either a nucleotide (default) or peptide query sequence.
  • Select the search program.
  • Select one or more databases to search.
  • Enter the sequences in fastaformat.


TBLASTN 2.0MP-WashU [27-Aug-2000] [linux-i686 21:46:47 28-Aug-2000]

Copyright (C) 1996-2000 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2000) http://blast.wustl.edu

Notice:  statistical significance is estimated under the assumption that the
equivalent of one entire reading frame of the database codes for protein and
that significant alignments will involve only coding reading frames.

Query=  gi_18408968_ref_NP_564924.1__ubiquitin-related__Arabidopsis_thaliana__
        (215 letters)

Database:  arab; barley; maize; potato; rice; soybean
           340,381 sequences; 280,672,813 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                     Reading  High  Probability
Sequences producing High-scoring Segment Pairs:        Frame Score  P(N)      N


arab|TC204667AAAAAAATAATATTCAAATTCAAAATCTGTCCAAATTCATC... +1   985  1.5e-98   1
potato|TC108015 weakly similar to UP|Q9PT08 (Q9PT08) S... +1   462  4.0e-43   1
soybean|TC179588                                          +1   423  6.2e-39   1
maize|TC223370                                            +2   399  1.2e-36   1
soybean|TC179590                                          +1   244  1.1e-31   2
barley|TC124695 similar to SP|P36338|UL47_HSVBC 80.7 k... +3   280  7.3e-24   1
rice|TC236090 Oryza sativa (japonica cultivar-group) c... +1   277  1.7e-23   1
rice|TC236088 similar to SP|P13378|HXD8_HUMAN Homeobox... +1   235  2.5e-18   1
maize|BM078275                                            -2   206  1.1e-15   1
soybean|TC179589                                          +3   169  8.2e-12   1
barley|CB872540                                           +1   134  7.5e-08   1
soybean|BU926774 homologue to GP|1707372|emb|CAA67923.... +2   117  3.3e-06   1
potato|TC95650 homologue to UP|Q9FLP6 (Q9FLP6) Ubiquit... +1   123  2.4e-05   1
soybean|TC192502 homologue to GP|20386084|gb|AAM21576.... +3   120  2.9e-05   1
arab|TC195614 SP|P55852|SMT3_ARATH Ubiquitin-like prot... +1   116  0.00017   1
potato|TC107002 homologue to UP|Q9SMD1 (Q9SMD1) SUMO p... +3   111  0.00020   1
potato|TC95983 homologue to SP|P55857|SMT3_ORYSA Ubiqu... +1   113  0.00026   1
rice|TC223668 Oryza sativa (japonica cultivar-group) c... +1   114  0.00032   1
maize|TC234143 homologue to SP|P55857|SMT3_ORYSA Ubiqu... +1   114  0.00042   1
maize|TC234142 homologue to SP|P55857|SMT3_ORYSA Ubiqu... +3   114  0.00048   1

Distribution of Blast Hits on the Query Sequence

WARNING:  Descriptions of 15 database sequences were not reported due to the
          limiting value of parameter V = 20.



>arab|TC204667AAAAAAATAATATTCAAATTCAAAATCTGTCCAAATTCATCTAGGGTTTCTGATAAAACA
        Length = 933

  Plus Strand HSPs:

 Score = 985 (351.8 bits), Expect = 1.5e-98, P = 1.5e-98
 Identities = 195/215 (90%), Positives = 195/215 (90%), Frame = +1

Query:     1 MGGEGEDLEPLFDYRRVQPANFVCIXXXXXXASVTPIPKKAKTSQTVEKLDDDVKVIEVT 60
             MGGEGEDLEPLFDYRRVQPANFVCI      ASVTPIPKKAKTSQTVEKLDDDVKVIEVT
Sbjct:    28 MGGEGEDLEPLFDYRRVQPANFVCIDDDDDDASVTPIPKKAKTSQTVEKLDDDVKVIEVT 207

Query:    61 GDDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQXXXXXXXXXXXX 120
             GDDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQ            
Sbjct:   208 GDDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQEVEESAKREVEE 387

Query:   121 XXNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDKAKLDPQ 180
               NPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDKAKLDPQ
Sbjct:   388 SRNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDKAKLDPQ 567

Query:   181 NLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             NLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT
Sbjct:   568 NLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 672


>potato|TC108015 weakly similar to UP|Q9PT08 (Q9PT08) Small ubiquitin-related
            protein 1, partial (29%)
        Length = 935

  Plus Strand HSPs:

 Score = 462 (167.7 bits), Expect = 4.0e-43, P = 4.0e-43
 Identities = 98/221 (44%), Positives = 133/221 (60%), Frame = +1

Query:     1 MGGEGEDLEPLFDYRRVQPAN----FVCIXXXXXXASVTPIPKKAKTSQTVEKLDDDVKV 56
             M    E+LEPLFDYRRVQP N     VC+      +S     K+     T EK  D  + 
Sbjct:    88 MDESNEELEPLFDYRRVQPFNTPFNVVCLDDDTPDSSPVISKKRKMIDSTAEKKKDKNEA 267

Query:    57 IEVTG----DDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQXXXX 112
             +++      ++DWL P P +    S + +EDSTIK +R KK EL SF ++  D ++    
Sbjct:   268 VQIIDCEEKEEDWLPPSPNISAHTS-NLLEDSTIKEIRLKKKELASFAQSAKDELRDVEE 444

Query:   113 XXXXXXXXXXNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYT 172
                       +   ++ A++PS+P+ DR K+VI+IQDKDG K  RV+AD+KFER+ K + 
Sbjct:   445 SVKRDLSASLHSLQDSVAEMPSKPSTDRVKMVISIQDKDGTKQFRVYADDKFERLFKSFA 624

Query:   173 DKAKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTK 213
             DK KL+ QNLVF FDGDKI+P+ TPS LGMED D+IEVH K
Sbjct:   625 DKVKLELQNLVFCFDGDKINPNATPSSLGMEDDDIIEVHEK 747


>soybean|TC179588
        Length = 811

  Plus Strand HSPs:

 Score = 423 (154.0 bits), Expect = 6.2e-39, P = 6.2e-39
 Identities = 96/220 (43%), Positives = 130/220 (59%), Frame = +1

Query:     1 MGGEGEDLEPLFDYRRVQPANFVCIXXXXXXAS--VTPIPKKAKTSQTV--EKLDDD-VK 55
             M  E E+LEPLFDY RVQP N + +          +    KK K SQ V  EK +   V 
Sbjct:    76 MMDETEELEPLFDYSRVQPLNPIDLDDDLDDYEDVICVDSKKRKNSQAVGNEKTNGKRVT 255

Query:    56 VIEVTGDDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQXXXXXXX 115
             V+++  DDDWL PPPK+  +  K + EDST+K LR KK EL SF ++  ++++       
Sbjct:   256 VVDIE-DDDWLPPPPKIASNAQKTTDEDSTLKKLRLKKQELASFAESAKELLKDVEESSK 432

Query:   116 XXXXXXXNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDKA 175
                      SS       S   ++RAKIVI++QDKDG K +R+F D+KFER++K+Y +K 
Sbjct:   433 LEINNSLQ-SSVVGVDEKSTEHSERAKIVISVQDKDGTKQIRMFMDDKFERIVKIYAEKI 609

Query:   176 KLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             K D + +V  FDGDKI  S TP+ LGMED D+IEVH K +
Sbjct:   610 KCDMKLIVLSFDGDKISLSETPASLGMEDDDIIEVHLKSS 729


>maize|TC223370
        Length = 1468

  Plus Strand HSPs:

 Score = 399 (145.5 bits), Expect = 1.2e-36, P = 1.2e-36
 Identities = 93/221 (42%), Positives = 131/221 (59%), Frame = +2

Query:     5 GEDLEPLFDYRRVQPANFVCIXXXXXX-ASVTPI-PKKAKTSQTVE--KLDDDV---KVI 57
             GEDLEPLFDY+RVQP    C        A +     K+ K   + E  K D++V   KV+
Sbjct:   191 GEDLEPLFDYKRVQPRMTFCFDDSDLEVADIFKYCNKRPKVHTSTEEGKPDEEVAAAKVV 370

Query:    58 EVTGDDDWLLPPP-KVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQXXXXXXXX 116
              V  ++DWL PPP K  F  + +  EDS  + LR KK E   F ++  D++Q        
Sbjct:   371 -VLDEEDWLQPPPPKAAFRATAE--EDSAFRELRLKKQEWAKFAESAEDILQKLDEITNK 541

Query:   117 XXXXXXNPSSETAAQLPSEPTNDRA--KIVITIQDKDGQKTLRVFADEKFERVIKLYTDK 174
                    P  +      SEP  ++A  KIVI+IQDKDGQ+ +RV+ DEKF++++K+Y  K
Sbjct:   542 EVGPK-EPPEQIILDEESEPQVEKAREKIVISIQDKDGQQQMRVYKDEKFDKLLKVYAKK 718

Query:   175 AKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             AKL+P +L F+FDG+KI+PS+TP +L +ED DMIEV  K++
Sbjct:   719 AKLNPSDLSFVFDGEKINPSSTPQDLDLEDEDMIEVRRKQS 841


>soybean|TC179590
        Length = 705

  Plus Strand HSPs:

 Score = 244 (91.0 bits), Expect = 1.1e-31, Sum P(2) = 1.1e-31
 Identities = 46/91 (50%), Positives = 63/91 (69%), Frame = +1

Query:   125 SSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDKAKLDPQNLVF 184
             SS       S   ++RAKIV+++QDKDG K +R+F D+KFER++K Y +K K + + +V 
Sbjct:   232 SSVVGVDEKSTEHSERAKIVVSVQDKDGTKQIRMFMDDKFERIVKTYAEKIKCNLKQIVL 411

Query:   185 IFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
              FDGDKI  S TP+ LGMED D+IEVH K +
Sbjct:   412 SFDGDKISSSETPASLGMEDDDIIEVHVKSS 504

 Score = 127 (49.8 bits), Expect = 1.1e-31, Sum P(2) = 1.1e-31
 Identities = 25/55 (45%), Positives = 37/55 (67%), Frame = +3

Query:    54 VKVIEVTGDDDWLLPPPKVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQ 108
             V V+++  DDDWL PPPK+  +  K   EDST+K LR KK EL SF ++  ++++
Sbjct:    24 VTVVDIE-DDDWLPPPPKIASNAQKTIDEDSTLKKLRLKKQELASFAESAKELLK 185


>barley|TC124695 similar to SP|P36338|UL47_HSVBC 80.7 kDa alpha trans-inducing
            protein (VP8 tegument protein) (VP7 protein) (107 kDa protein).
            [strain Cooper] {Bovine herpesvirus type 1}, partial (3%)
        Length = 994

  Plus Strand HSPs:

 Score = 280 (103.6 bits), Expect = 7.3e-24, P = 7.3e-24
 Identities = 80/227 (35%), Positives = 109/227 (48%), Frame = +3

Query:     2 GGEGEDLEPLFDYRRVQPANFVCIXXXXXXASVTPI-----PKKAKTSQTVE------KL 50
             G + E+LEPLFDY RVQP    C        S   +     PK A  +   E      K 
Sbjct:   111 GADSEELEPLFDYSRVQPTIDFCFDDSDLEKSDIFVHCNKRPKVADDANADEGGKGNEKG 290

Query:    51 DDDVKVIEVTG--DDDWLLPPP-KVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVM 107
             D  +K   V    D+DWL PPP K +   S D  +D T+   R KK E+    K V D  
Sbjct:   291 DTGIKKAMVVNLDDEDWLAPPPLKPVL--SADVCKDKTMHE-RLKKQEVQ---KLVDDEF 452

Query:   108 QXXXXXXXXXXXXXXNPSSETAAQ-LPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFER 166
             Q               P      +   +E    + KI I  Q+KD ++  RV  DEKF++
Sbjct:   453 QKVVENVKKDMLAKKPPEPIVLDEPTETETKKSKEKICIMFQEKDARQQFRVSMDEKFDK 632

Query:   167 VIKLYTDKAKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTK 213
             + K+Y  K +L P +L+FIFDGDKI+ ++T  +L +E+ DMIEV  K
Sbjct:   633 LFKVYAKKVQLSPSDLIFIFDGDKINSASTLQDLELENGDMIEVRRK 773


>rice|TC236090 Oryza sativa (japonica cultivar-group) cDNA clone:002-188-C07,
            full insert sequence
        Length = 1274

  Plus Strand HSPs:

 Score = 277 (102.6 bits), Expect = 1.7e-23, P = 1.7e-23
 Identities = 72/221 (32%), Positives = 102/221 (46%), Frame = +1

Query:     6 EDLEPLFDYRRVQPANFVCIXXXXXXAS--VTPIPKKAKTSQ------TVEKLDDD---- 53
             E+LEPLFDY RVQP             S       K+ K +         EK D      
Sbjct:   232 EELEPLFDYSRVQPTMAFSFDDTDIEKSDIFVHCNKRRKVADGDGDANADEKGDKGEQKA 411

Query:    54 VKVIEVT--GDDDWLLPPP--KVIFDKSKDSVEDSTIKALRSKKMELMSFTKTVGDVMQX 109
              K   V   G++DWL PPP  K     + +S + S +K LR +K  +  F ++  D ++ 
Sbjct:   412 AKAAAVVDLGEEDWLPPPPPPKPKSTVTDESEQSSVLKELRLQKQAMAKFAESADDFLEK 591

Query:   110 XXXXXXXXXXXXXNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERVIK 169
                           P+         E    R K+V+T+QDK G    R++ DEKF ++ +
Sbjct:   592 LAQTARQKVEARI-PTEHIDLDKSPERHEAREKVVVTVQDKAGHHQFRLYKDEKFGKLFR 768

Query:   170 LYTDKAKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEV 210
              Y  K  L   +L F FDGDK+D  +TP +LG+ED DM+EV
Sbjct:   769 AYAKKVNLSVADLTFAFDGDKVDAESTPEDLGLEDEDMVEV 891


>rice|TC236088 similar to SP|P13378|HXD8_HUMAN Homeobox protein Hox-D8 (Hox-4E)
            (Hox-5.4). {Homo sapiens;}, partial (6%)
        Length = 2301

  Plus Strand HSPs:

 Score = 235 (87.8 bits), Expect = 2.5e-18, P = 2.5e-18
 Identities = 54/166 (32%), Positives = 83/166 (50%), Frame = +1

Query:    56 VIEVTGDDDWLLPPP--KVIFDKSKDSVEDSTIKALRSK---------KMELMSFTKTVG 104
             V+++ G++DWL PPP  K     + +S + S +K LR K         K  +  F ++  
Sbjct:  1792 VVDL-GEEDWLPPPPPPKPKSTVTDESEQSSVLKELRYKPVHGSILLQKQAMAKFAESAD 1968

Query:   105 DVMQXXXXXXXXXXXXXXNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKF 164
             D ++               P+         E    R K+V+T+QDK G    R++ DEKF
Sbjct:  1969 DFLEKLAQTARQKVEARI-PTEHIDLDKSPERHEAREKVVVTVQDKAGHHQFRLYKDEKF 2145

Query:   165 ERVIKLYTDKAKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEV 210
              ++ + Y  K  L   +L F FDGDK+D  +TP +LG+ED DM+EV
Sbjct:  2146 GKLFRAYAKKVNLSVADLTFAFDGDKVDAESTPEDLGLEDEDMVEV 2283

 Score = 83 (34.3 bits), Expect = 3.8, P = 0.98
 Identities = 34/103 (33%), Positives = 43/103 (41%), Frame = +1

Query:     6 EDLEPLFDYRRVQPANFVCIXXXXXXAS--VTPIPKKAKTSQ------TVEKLDDD---- 53
             E+LEPLFDY RVQP             S       K+ K +         EK D      
Sbjct:  1597 EELEPLFDYSRVQPTMAFSFDDTDIEKSDIFVHCNKRRKVADGDGDANADEKGDKGEQKA 1776

Query:    54 VKVIEVT--GDDDWLLPPP--KVIFDKSKDSVEDSTIKALRSK 92
              K   V   G++DWL PPP  K     + +S + S +K LR K
Sbjct:  1777 AKAAAVVDLGEEDWLPPPPPPKPKSTVTDESEQSSVLKELRYK 1905


>maize|BM078275
        Length = 446

  Minus Strand HSPs:

 Score = 206 (77.6 bits), Expect = 1.1e-15, P = 1.1e-15
 Identities = 39/76 (51%), Positives = 56/76 (73%), Frame = -2

Query:   140 RAKIVITIQDKDGQKTLRVFADEKFERVIKLYTDKAKLDPQNLVFIFDGDKIDPSTTPSE 199
             R KIVI+IQ KDGQ  + V+ DEKF ++ K+Y  KAKL+P +L F+FDG+KI+PS TP  
Sbjct:   346 REKIVISIQGKDGQHQMGVYKDEKFAKLFKVYAKKAKLNPSDLSFVFDGEKINPSFTPQA 167

Query:   200 LGMEDHDMIEVHTKKT 215
             L +ED ++ +V  K++
Sbjct:   166 LDLEDENINKVRRKQS 119


>soybean|TC179589
        Length = 506

  Plus Strand HSPs:

 Score = 169 (64.5 bits), Expect = 8.2e-12, P = 8.2e-12
 Identities = 31/55 (56%), Positives = 41/55 (74%), Frame = +3

Query:   161 DEKFERVIKLYTDKAKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             D+KFER++K+Y +K K D + +V  FDGDKI  S TP+ LGMED D+IEVH K +
Sbjct:    96 DDKFERIVKIYAEKIKCDMKLIVLSFDGDKISLSETPASLGMEDDDIIEVHLKSS 260


>barley|CB872540
        Length = 285

  Plus Strand HSPs:

 Score = 134 (52.2 bits), Expect = 7.5e-08, P = 7.5e-08
 Identities = 25/58 (43%), Positives = 37/58 (63%), Frame = +1

Query:   158 VFADEKFERVIKLYTDKAKLDPQNLVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             V  +EKF+ + K Y +K ++ P NL F FDGDKI+P++ P  L +   ++IEVH   T
Sbjct:    43 VLKNEKFDNLFKAYANKVQITPSNLTFGFDGDKINPTSPPQHLDLYT*NLIEVHHNPT 216


>soybean|BU926774 homologue to GP|1707372|emb|CAA67923.1||X99609 ubiquitin-like
            protein {Arabidopsis thaliana}, partial (88%)
        Length = 445

  Plus Strand HSPs:

 Score = 117 (46.2 bits), Expect = 3.3e-06, P = 3.3e-06
 Identities = 23/82 (28%), Positives = 46/82 (56%), Frame = +2

Query:   135 EPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVFIFDGDKIDP 193
             +P++  A I + ++ +DG +   R+    + ++++  Y D+  +D  ++ F+FDG ++  
Sbjct:    80 KPSDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRA 259

Query:   194 STTPSELGMEDHDMIEVHTKKT 215
               TP EL MED D I+    +T
Sbjct:   260 EQTPDELEMEDGDEIDAMLHQT 325


>potato|TC95650 homologue to UP|Q9FLP6 (Q9FLP6) Ubiquitin-like protein
            SMT3-like (AT5g55160/MCO15_11) (Small ubiquitin-like modifier 2),
            partial (85%)
        Length = 689

  Plus Strand HSPs:

 Score = 123 (48.4 bits), Expect = 2.4e-05, P = 2.4e-05
 Identities = 26/91 (28%), Positives = 50/91 (54%), Frame = +1

Query:   126 SETAAQLPSEPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVF 184
             S+TA +   +P  D+  I + ++ +DG +   R+    + ++++  Y D+  +D  ++ F
Sbjct:    46 SQTAEE-DKKPGGDQIHINLKVKSQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAF 222

Query:   185 IFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             +FDG ++    TP EL MED D I+    +T
Sbjct:   223 LFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 315


>soybean|TC192502 homologue to GP|20386084|gb|AAM21576.1|AF451278_1|AF451278
            ubiquitin-like protein SMT3 {Phaseolus vulgaris}, complete
        Length = 569

  Plus Strand HSPs:

 Score = 120 (47.3 bits), Expect = 2.9e-05, P = 2.9e-05
 Identities = 24/82 (29%), Positives = 45/82 (54%), Frame = +3

Query:   135 EPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVFIFDGDKIDP 193
             +PT   A I + ++ +DG +   R+    + ++++  Y D+  +D  ++ F+FDG ++  
Sbjct:   114 KPTEQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRA 293

Query:   194 STTPSELGMEDHDMIEVHTKKT 215
               TP EL MED D I+    +T
Sbjct:   294 EQTPDELEMEDGDEIDAMLHQT 359


>arab|TC195614 SP|P55852|SMT3_ARATH Ubiquitin-like protein SMT3. [Mouse-ear
            cress] {Arabidopsis thaliana},
            completeAAAAGCCACGGCCAATTAGAGAGATTTTCAGAGTCAGTCTTTTTATATTCATCTCTCAG
            C
        Length = 650

  Plus Strand HSPs:

 Score = 116 (45.9 bits), Expect = 0.00017, P = 0.00017
 Identities = 23/82 (28%), Positives = 45/82 (54%), Frame = +1

Query:   135 EPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVFIFDGDKIDP 193
             +P +  A I + ++ +DG +   R+    + ++++  Y D+  +D  ++ F+FDG ++  
Sbjct:   106 KPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRA 285

Query:   194 STTPSELGMEDHDMIEVHTKKT 215
               TP EL MED D I+    +T
Sbjct:   286 EQTPDELDMEDGDEIDAMLHQT 351


>potato|TC107002 homologue to UP|Q9SMD1 (Q9SMD1) SUMO protein, partial (92%)
        Length = 496

  Plus Strand HSPs:

 Score = 111 (44.1 bits), Expect = 0.00020, P = 0.00020
 Identities = 23/92 (25%), Positives = 46/92 (50%), Frame = +3

Query:   125 SSETAAQLPSEPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLV 183
             +S  A     +P +    I + ++ +DG +   R+    +  +++  Y D+  +D  ++ 
Sbjct:    69 ASGGAGDEDKKPNDQMVHINLKVKGQDGNEVFFRIKRSTQMRKLMNAYCDRQSVDMNSIA 248

Query:   184 FIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             F+FDG ++    TP EL ME+ D I+    +T
Sbjct:   249 FLFDGRRLRAEQTPDELEMEEGDEIDAMLHQT 344


>potato|TC95983 homologue to SP|P55857|SMT3_ORYSA Ubiquitin-like protein SMT3.
            {Oryza sativa;}, partial (88%)
        Length = 561

  Plus Strand HSPs:

 Score = 113 (44.8 bits), Expect = 0.00026, P = 0.00026
 Identities = 23/83 (27%), Positives = 46/83 (55%), Frame = +1

Query:   135 EPTNDRA-KIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVFIFDGDKID 192
             +P  D++  I + ++ +DG +   R+    + ++++  Y D+  +D  ++ F+FDG ++ 
Sbjct:    64 KPAGDQSGHINLKVKSQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLR 243

Query:   193 PSTTPSELGMEDHDMIEVHTKKT 215
                TP EL MED D I+    +T
Sbjct:   244 AEQTPDELEMEDGDEIDAMLHQT 312


>rice|TC223668 Oryza sativa (japonica cultivar-group) cDNA clone:001-103-A02,
            full insert sequence
        Length = 650

  Plus Strand HSPs:

 Score = 114 (45.2 bits), Expect = 0.00032, P = 0.00032
 Identities = 24/94 (25%), Positives = 51/94 (54%), Frame = +1

Query:   123 NPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQN 181
             +P+ E   + P+      A I + ++ +DG +   R+    + ++++  Y D+  +D ++
Sbjct:   127 SPAGEDEKK-PAGGEGGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDIKS 303

Query:   182 LVFIFDGDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             + F+FDG +++   TP +L MED D I+    +T
Sbjct:   304 IAFLFDGRRLNAEQTPDQLEMEDGDEIDAMLHQT 405


>maize|TC234143 homologue to SP|P55857|SMT3_ORYSA Ubiquitin-like protein SMT3.
            [Rice] {Oryza sativa}, partial (93%)
        Length = 746

  Plus Strand HSPs:

 Score = 114 (45.2 bits), Expect = 0.00042, P = 0.00042
 Identities = 24/88 (27%), Positives = 45/88 (51%), Frame = +1

Query:   129 AAQLPSEPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVFIFD 187
             A +   +P    A I + ++ +DG +   R+    + ++++  Y D+  +D   + F+FD
Sbjct:   121 AGEEDKKPAEGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNAIAFLFD 300

Query:   188 GDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             G ++    TP EL MED D I+    +T
Sbjct:   301 GRRLRGEQTPDELEMEDGDEIDAMLHQT 384


>maize|TC234142 homologue to SP|P55857|SMT3_ORYSA Ubiquitin-like protein SMT3.
            [Rice] {Oryza sativa}, partial (93%)
        Length = 817

  Plus Strand HSPs:

 Score = 114 (45.2 bits), Expect = 0.00048, P = 0.00048
 Identities = 24/88 (27%), Positives = 45/88 (51%), Frame = +3

Query:   129 AAQLPSEPTNDRAKIVITIQDKDGQKTL-RVFADEKFERVIKLYTDKAKLDPQNLVFIFD 187
             A +   +P    A I + ++ +DG +   R+    + ++++  Y D+  +D   + F+FD
Sbjct:    84 AGEEDKKPAEGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNAIAFLFD 263

Query:   188 GDKIDPSTTPSELGMEDHDMIEVHTKKT 215
             G ++    TP EL MED D I+    +T
Sbjct:   264 GRRLRGEQTPDELEMEDGDEIDAMLHQT 347


WARNING:  HSPs involving 15 database sequences were not reported due to the
          limiting value of parameter B = 20.


Parameters:
  B=20
  cpus=1
  matrix=blosum62
  E=10
  V=20
  filter=seg

  ctxfactor=6.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   blosum62        0.313   0.133   0.371    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E    S W   T  X   E2     S2
   +0      0      215       215       10.  74 3  13 23  0.062   37
                                                    32  0.068   40


Statistics:

  Database:  arab; barley; maize; potato; rice; soybean
   Title:  arab; barley; maize; potato; rice; soybean
   Format:  VirtualDB
   # of letters in database:  280,672,813
   # of sequences in database:  340,381
   # of database sequences satisfying E:  35
  No. of states in DFA:  383 (41 KB)
  Total size of DFA:  54 KB (64 KB)
  Time to generate neighborhood:  0.01u 0.00s 0.01t  Elapsed: 00:00:00
  No. of threads or processors used:  1
  Search cpu time:  74.02u 0.84s 74.86t  Elapsed: 00:02:17
  Total cpu time:  74.05u 0.88s 74.93t  Elapsed: 00:02:19
  Start:  Tue Jul  6 21:21:29 2004   End:  Tue Jul  6 21:23:48 2004

WARNINGS ISSUED:  2




Data Availability


Comments and suggestions: contact us

TIGR Frequently Asked Questions
1999-2002 TIGR
Gene Index Frequently Asked Questions
TIGR Databases | What's New | About TIGR | TIGR Faculty
TIGR Gene Indices | Conferences, Education and Training
TIGR Software | Career Opportunities | Related Links