analysis of sequence from tem42 ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ >tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQ NNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITM KNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ sec.str. with predator > tem42gi|3914625|sp|O15539|RGS5_HUMAN . . . . . 1 MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKT 50 __________HHHHHHHHHHHHHHHEEE______EEEEE___________ . . . . . 51 QKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDY 100 HHHHHHHHHHHHHHHHHHHHHH____HHHHHHHHHHHHHHHHHHHHH___ . . . . . 101 KKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSS 150 _______HHHHHHHHHHHHHHHH_____EEEE_________________H . . . 151 FDMAQKRIHALMEKDSLPRFVRSEFYQELIK 181 HHHHHHHHHHHHHH______HHHHHHHH___ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ method : 1 alpha-contents : 84.4 % beta-contents : 0.0 % coil-contents : 15.6 % class : alpha method : 2 alpha-contents : 66.0 % beta-contents : 0.0 % coil-contents : 34.0 % class : alpha ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ GPI: learning from metazoa -21.13 -0.54 -0.08 -0.16 -4.00 -4.00 -4.00 0.00 -0.37 -10.03 -3.01 -12.00 -12.00 0.00 -12.00 0.00 -83.32 -19.34 -1.08 -0.77 -0.11 -4.00 0.00 0.00 0.00 -0.43 -10.03 -3.01 -12.00 -12.00 0.00 -12.00 0.00 -74.78 ID: tem42gi|3914625|sp|O15539|RGS5_HUMAN AC: xxx Len: 140 1:I 123 Sc: -74.78 Pv: 6.694458e-01 NO_GPI_SITE GPI: learning from protozoa -33.03 -0.54 -0.23 0.00 -4.00 -4.00 -4.00 0.00 -0.04 -8.53 -10.55 -12.00 -12.00 0.00 -12.00 0.00 -100.93 -34.69 -1.17 -1.76 -1.62 -4.00 0.00 0.00 0.00 -0.06 -8.53 -10.55 -12.00 -12.00 0.00 -12.00 0.00 -98.38 ID: tem42gi|3914625|sp|O15539|RGS5_HUMAN AC: xxx Len: 140 1:I 123 Sc: -98.38 Pv: 8.400459e-01 NO_GPI_SITE ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ # SignalP euk predictions # name Cmax pos ? Ymax pos ? Smax pos ? Smean ? tem42gi|391 0.297 174 N 0.112 16 N 0.554 1 N 0.216 N # SignalP gram- predictions # name Cmax pos ? Ymax pos ? Smax pos ? Smean ? tem42gi|391 0.375 17 N 0.339 17 N 0.794 4 N 0.368 N # SignalP gram+ predictions # name Cmax pos ? Ymax pos ? Smax pos ? Smean ? tem42gi|391 0.312 113 N 0.169 88 N 0.839 4 N 0.158 N ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ low complexity regions: SEG 12 2.2 2.5 >tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) 1-76 MCKGLAALPHSCLERAKEIKIKLGILLQKP DSVGDLVIPYNEKPEKPAKTQKTSLDEALQ WRDSLDKLLQNNYGLA sfksflksefseenlef 77-93 94-181 WIACEDYKKIKSPAKMAEKAKQIYEEFIQT EAPKEVNIDHFTKDITMKNLVEPSLSSFDM AQKRIHALMEKDSLPRFVRSEFYQELIK low complexity regions: SEG 25 3.0 3.3 >tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) 1-181 MCKGLAALPHSCLERAKEIKIKLGILLQKP DSVGDLVIPYNEKPEKPAKTQKTSLDEALQ WRDSLDKLLQNNYGLASFKSFLKSEFSEEN LEFWIACEDYKKIKSPAKMAEKAKQIYEEF IQTEAPKEVNIDHFTKDITMKNLVEPSLSS FDMAQKRIHALMEKDSLPRFVRSEFYQELI K low complexity regions: SEG 45 3.4 3.75 >tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) 1-181 MCKGLAALPHSCLERAKEIKIKLGILLQKP DSVGDLVIPYNEKPEKPAKTQKTSLDEALQ WRDSLDKLLQNNYGLASFKSFLKSEFSEEN LEFWIACEDYKKIKSPAKMAEKAKQIYEEF IQTEAPKEVNIDHFTKDITMKNLVEPSLSS FDMAQKRIHALMEKDSLPRFVRSEFYQELI K low complexity regions: XNU # Score cutoff = 21, Search from offsets 1 to 4 # both members of each repeat flagged # lambda = 0.347, K = 0.200, H = 0.664 >tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNekpekpaktqktSLDEALQ WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI K 1 - 41 MCKGLAALPH SCLERAKEIK IKLGILLQKP DSVGDLVIPY N 42 - 53 ekpekpakt qkt 54 - 181 SLDEALQ WRDSLDKLLQ NNYGLASFKS FLKSEFSEEN LEFWIACEDY KKIKSPAKMA EKA KQIYEEF IQTEAPKEVN IDHFTKDITM KNLVEPSLSS FDMAQKRIHA LMEKDSLPRF VRS EFYQELI K low complexity regions: DUST >tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQ WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI K ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ coiled coil prediction for tem42gi|3914625|sp|O15539|RGS5_HUMAN sequence: 140 amino acids, 0 residue(s) in coiled coil state . | . | . | . | . | . 60 MCKGLAALPH SCLERAKEIK IKLGILLQKP DSVGDLVIPY NEKPEKPAKT QKTSLDEALQ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 21 M'95 -w border ---------- ---------- ---------- ---------- ---------- ---------- * 21 M'95 -w register ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 21 M'95 +w polar ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 21 MTK -w class ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 28 M'95 -w signif. ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 14 M'95 -w local . | . | . | . | . | . 120 WRDSLDKLLQ NNYGLASFKS FLKSEFSEEN LEFWIACEDY KKIKSPAKMA EKAKQIYEEF ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 21 M'95 -w border ---------- ---------- ---------- ---------- ---------- ---------- * 21 M'95 -w register ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 21 M'95 +w polar ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 21 MTK -w class ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 28 M'95 -w signif. ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ * 14 M'95 -w local . | . | IQTEAPKEVN IDHFTKDITM ~~~~~~~~~~ ~~~~~~~~~~ ---------- ---------- ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ prediction of transmembrane regions with toppred2 *********************************** *TOPPREDM with eukaryotic function* *********************************** tem42.___inter___ is a single sequence Using hydrophobicity file: /bio_software/2D/toppredm/lib/Engelman-Steitz.scale Using cyt/ext file: /bio_software/2D/toppredm/lib/Cyt-Ext.prok Using sequence file: tem42.___inter___ (1 sequences) MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKT QKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDY KKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSS FDMAQKRIHALMEKDSLPRFVRSEFYQELIK (p)rokaryotic or (e)ukaryotic: e Charge-pair energy: 0 Length of full window (odd number!): 21 Length of core window (odd number!): 11 Number of residues to add to each end of helix: 1 Critical length: 60 Upper cutoff for candidates: 1 Lower cutoff for candidates: 0.6 Total of 1 structures are to be tested Candidate membrane-spanning segments: Helix Begin End Score Certainity ---------------------------------------------------------------------- Structure 1 Transmembrane segments included in this structure: Segment Loop length 181 K+R profile + CYT-EXT prof -0.34 For CYT-EXT profile neg. values indicate cytoplasmic preference. K+R difference: 0.00 Tm probability: 1.00 -> Orientation: undecided Charge-difference over N-terminal Tm (+-15 residues): -1.00 (NEG-POS)/(NEG+POS): 0.0175 NEG: 29.0000 POS: 28.0000 -> Orientation: N-out CYT-EXT difference: -0.34 -> Orientation: N-in ---------------------------------------------------------------------- "tem42" 181 ************************************ *TOPPREDM with prokaryotic function* ************************************ tem42.___inter___ is a single sequence Using hydrophobicity file: /bio_software/2D/toppredm/lib/Engelman-Steitz.scale Using cyt/ext file: /bio_software/2D/toppredm/lib/Cyt-Ext.prok Using sequence file: tem42.___inter___ (1 sequences) MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKT QKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDY KKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSS FDMAQKRIHALMEKDSLPRFVRSEFYQELIK (p)rokaryotic or (e)ukaryotic: p Charge-pair energy: 0 Length of full window (odd number!): 21 Length of core window (odd number!): 11 Number of residues to add to each end of helix: 1 Critical length: 60 Upper cutoff for candidates: 1 Lower cutoff for candidates: 0.6 Total of 1 structures are to be tested Candidate membrane-spanning segments: Helix Begin End Score Certainity ---------------------------------------------------------------------- Structure 1 Transmembrane segments included in this structure: Segment Loop length 181 K+R profile + CYT-EXT prof -0.34 For CYT-EXT profile neg. values indicate cytoplasmic preference. K+R difference: 0.00 Tm probability: 1.00 -> Orientation: undecided Charge-difference over N-terminal Tm (+-15 residues): -1.00 (NEG-POS)/(NEG+POS): 0.0175 NEG: 29.0000 POS: 28.0000 -> Orientation: N-out CYT-EXT difference: -0.34 -> Orientation: N-in ---------------------------------------------------------------------- "tem42" 181 ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ NOW EXECUTING: /bio_software/1D/stat/saps/saps-stroh/SAPS.SSPA/saps /people/maria/tem42.___saps___ SAPS. Version of April 11, 1996. Date run: Thu Nov 2 11:53:55 2000 File: /people/maria/tem42.___saps___ ID tem42gi|3914625|sp|O15539|RGS5_HUMAN DE REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) number of residues: 181; molecular weight: 20.9 kdal 1 MCKGLAALPH SCLERAKEIK IKLGILLQKP DSVGDLVIPY NEKPEKPAKT QKTSLDEALQ 61 WRDSLDKLLQ NNYGLASFKS FLKSEFSEEN LEFWIACEDY KKIKSPAKMA EKAKQIYEEF 121 IQTEAPKEVN IDHFTKDITM KNLVEPSLSS FDMAQKRIHA LMEKDSLPRF VRSEFYQELI 181 K -------------------------------------------------------------------------------- COMPOSITIONAL ANALYSIS (extremes relative to: swp23s) A : 13( 7.2%); C : 3( 1.7%); D : 10( 5.5%); E : 19(10.5%); F : 9( 5.0%) G : 4( 2.2%); H : 3( 1.7%); I : 12( 6.6%); K : 24(13.3%); L : 20(11.0%) M : 5( 2.8%); N : 6( 3.3%); P : 9( 5.0%); Q : 8( 4.4%); R : 5( 2.8%) S : 14( 7.7%); T : 5( 2.8%); V : 5( 2.8%); W : 2( 1.1%); Y : 5( 2.8%) KR : 29 ( 16.0%); ED : 29 ( 16.0%); AGP : 26 ( 14.4%); KRED : 58 ( 32.0%); KR-ED : 0 ( 0.0%); FIKMNY : 61 ( 33.7%); LVIFM : 51 ( 28.2%); ST : 19 ( 10.5%). -------------------------------------------------------------------------------- CHARGE DISTRIBUTIONAL ANALYSIS 1 00+0000000 000-+0+-0+ 0+000000+0 -000-00000 0-+0-+00+0 0+000--000 61 0+-00-+000 00000000+0 00+0-00--0 0-00000--0 ++0+000+00 -+0+000--0 121 000-00+-00 0-000+-000 +000-00000 0-000++000 00-+-000+0 0+0-000-00 181 + A. CHARGE CLUSTERS. Positive charge clusters (cmin = 12/30 or 17/45 or 20/60): none Negative charge clusters (cmin = 12/30 or 17/45 or 20/60): none Mixed charge clusters (cmin = 19/30 or 26/45 or 33/60): none B. HIGH SCORING (UN)CHARGED SEGMENTS. There are no high scoring positive charge segments. There are no high scoring negative charge segments. There are no high scoring mixed charge segments. There are no high scoring uncharged segments. C. CHARGE RUNS AND PATTERNS. pattern (+)| (-)| (*)| (0)| (+0)| (-0)| (*0)|(+00)|(-00)|(*00)| (H.)|(H..)| lmin0 5 | 5 | 8 | 22 | 9 | 9 | 13 | 10 | 10 | 14 | 6 | 7 | lmin1 7 | 7 | 10 | 27 | 11 | 11 | 16 | 13 | 13 | 17 | 7 | 9 | lmin2 8 | 8 | 12 | 30 | 13 | 13 | 18 | 14 | 14 | 19 | 8 | 10 | (Significance level: 0.010000; Minimal displayed length: 6) There are no charge runs or patterns exceeding the given minimal lengths. Run count statistics: + runs >= 4: 0 - runs >= 4: 0 * runs >= 6: 0 0 runs >= 15: 0 -------------------------------------------------------------------------------- DISTRIBUTION OF OTHER AMINO ACID TYPES 1. HIGH SCORING SEGMENTS. There are no high scoring hydrophobic segments. There are no high scoring transmembrane segments. 2. SPACINGS OF C. H2N-1-C-9-C-84-C-84-COOH 2*. SPACINGS OF C and H. (additional deluxe function for ALEX) H2N-1-C-7-H-1-C-84-C-35-H-25-H-22-COOH -------------------------------------------------------------------------------- REPETITIVE STRUCTURES. A. SEPARATED, TANDEM, AND PERIODIC REPEATS: amino acid alphabet. Repeat core block length: 4 B. SEPARATED AND TANDEM REPEATS: 11-letter reduced alphabet. (i= LVIF; += KR; -= ED; s= AG; o= ST; n= NQ; a= YW; p= P; h= H; m= M; c= C) Repeat core block length: 8 -------------------------------------------------------------------------------- MULTIPLETS. A. AMINO ACID ALPHABET. 1. Total number of amino acid multiplets: 8 (Expected range: 1-- 22) 2. Histogram of spacings between consecutive amino acid multiplets: (1-5) 1 (6-10) 1 (11-20) 4 (>=21) 3 3. Clusters of amino acid multiplets (cmin = 9/30 or 11/45 or 14/60): none B. CHARGE ALPHABET. 1. Total number of charge multiplets: 6 (Expected range: 0-- 17) 2 +plets (f+: 16.0%), 4 -plets (f-: 16.0%) Total number of charge altplets: 10 (Critical number: 19) 2. Histogram of spacings between consecutive charge multiplets: (1-5) 1 (6-10) 1 (11-20) 1 (>=21) 4 ------------------------------ -------------------------------------------------- PERIODICITY ANALYSIS. A. AMINO ACID ALPHABET (core: 4; !-core: 5) Location Period Element Copies Core Errors 43- 54 3 K.. 4 4 0 B. CHARGE ALPHABET ({+= KR; -= ED; 0}; core: 5; !-core: 7) and HYDROPHOBICITY ALPHABET ({*= KRED; i= LVIF; 0}; core: 6; !-core: 9) Location Period Element Copies Core Errors There are no periodicities of the prescribed length. -------------------------------------------------------------------------------- SPACING ANALYSIS. There are no unusual spacings. ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ Start with Pfam (from /data/patterns/pfam) hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/patterns/pfam/Pfam Sequence file: tem42 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RGS Regulator of G protein signaling domai 169.1 7.3e-47 1 Diphtheria_tox Diphtheria toxin -2.8 91 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- Diphtheria_tox 1/1 111 123 .. 266 278 .. -2.8 91 RGS 1/1 64 180 .. 1 143 [] 169.1 7.3e-47 Alignments of top-scoring domains: Diphtheria_tox: domain 1 of 1, from 111 to 123: score -2.8, E = 91 *->EKAKqYLEEFHqt<-* EKAKq EEF qt tem42gi|39 111 EKAKQIYEEFIQT 123 RGS: domain 1 of 1, from 64 to 180: score 169.1, E = 7.3e-47 *->sfeklldkqpiGrllFreFLetefsepkenleFwlaveeyektespa s++kll ++ +G++ F+ FL++efse enleFw+a+e+y+k +sp tem42gi|39 64 SLDKLL-QNNYGLASFKSFLKSEFSE--ENLEFWIACEDYKKIKSP- 106 dkrsdkarekesLaaAYGIydeFispeapkfevnldselrestqdnllea k+ +ka++ Iy+eFi eapk evn+d+ + + t +nl e tem42gi|39 107 AKMAEKAKQ---------IYEEFIQTEAPK-EVNIDHFTKDITMKNLVE- 145 vededllksLqptkdlFeeaqreiytlMrgDSfprFLeSdyylrfL<-* p+ F++aq++i+ lM++DS prF +S++y++++ tem42gi|39 146 -----------PSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI 180 // Start with PfamFrag (from /data/patterns/pfam) hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/patterns/pfam/PfamFrag Sequence file: tem42 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- RGS Regulator of G protein signaling domai 169.1 7.3e-47 1 HAT HAT (Half-A-TPR) repeat 1.9 52 1 Diphtheria_tox Diphtheria toxin -2.8 91 1 Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- HAT 1/1 108 121 .. 1 14 [. 1.9 52 Diphtheria_tox 1/1 111 123 .. 266 278 .. -2.8 91 RGS 1/1 64 180 .. 1 143 [] 169.1 7.3e-47 Alignments of top-scoring domains: HAT: domain 1 of 1, from 108 to 121: score 1.9, E = 52 *->kEidRAReiYeRFv<-* k ++A++iYe F+ tem42gi|39 108 KMAEKAKQIYEEFI 121 Diphtheria_tox: domain 1 of 1, from 111 to 123: score -2.8, E = 91 *->EKAKqYLEEFHqt<-* EKAKq EEF qt tem42gi|39 111 EKAKQIYEEFIQT 123 RGS: domain 1 of 1, from 64 to 180: score 169.1, E = 7.3e-47 *->sfeklldkqpiGrllFreFLetefsepkenleFwlaveeyektespa s++kll ++ +G++ F+ FL++efse enleFw+a+e+y+k +sp tem42gi|39 64 SLDKLL-QNNYGLASFKSFLKSEFSE--ENLEFWIACEDYKKIKSP- 106 dkrsdkarekesLaaAYGIydeFispeapkfevnldselrestqdnllea k+ +ka++ Iy+eFi eapk evn+d+ + + t +nl e tem42gi|39 107 AKMAEKAKQ---------IYEEFIQTEAPK-EVNIDHFTKDITMKNLVE- 145 vededllksLqptkdlFeeaqreiytlMrgDSfprFLeSdyylrfL<-* p+ F++aq++i+ lM++DS prF +S++y++++ tem42gi|39 146 -----------PSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI 180 // Start with Repeat Library (from /data/patterns/repeats-Miguel-Andrade/hmm) hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/patterns/repeats-Miguel-Andrade/hmm/repeats.hmm-lib Sequence file: tem42 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- [no hits above thresholds] Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- [no hits above thresholds] Alignments of top-scoring domains: [no hits above thresholds] // ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ Start with Prosite --------------------------------------------------------- | ppsearch (c) 1994 EMBL Data Library | | based on MacPattern (c) 1990-1994 R. Fuchs | --------------------------------------------------------- PROSITE pattern search started: Thu Nov 2 11:55:30 2000 Sequence file: tem42 ---------------------------------------- Sequence tem42gi|3914625|sp|O15539|RGS5_HUMAN (181 residues): Matching pattern PS00005 PKC_PHOSPHO_SITE: 50: TQK 77: SFK 139: TMK Total matches: 3 Matching pattern PS00006 CK2_PHOSPHO_SITE: 11: SCLE 32: SVGD 53: TSLD 54: SLDE 149: SSFD Total matches: 5 Total no of hits in this sequence: 8 ======================================== 1314 pattern(s) searched in 1 sequence(s), 181 residues. Total no of hits in all sequences: 8. Search time: 00:00 min ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ Start with Profile Search ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ Start with motif search against own library ***** bioMotif : Version V41a DB, 1999 Nov 11 ***** argv[1]=P argv[2]=-m /data/patterns/own/motif.fa argv[4]=-seq tem42 ***** bioMotif : Version V41a DB, 1999 Nov 11 ***** SeqTyp=2 : PROTEIN search; >APC D-Box is the MOTIF name >STATISTICS Total : 0 solutions in 0 sequences, 0 units; out of 1 sequences, 181 units ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~ ~~~ Start with HMM-search search against own library hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/patterns/own/own-hmm.lib Sequence file: tem42 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- [no hits above thresholds] Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- [no hits above thresholds] Alignments of top-scoring domains: [no hits above thresholds] // hmmpfam - search a single seq against HMM database HMMER 2.1.1 (Dec 1998) Copyright (C) 1992-1998 Washington University School of Medicine HMMER is freely distributed under the GNU General Public License (GPL). - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - HMM file: /data/patterns/own/own-hmm-f.lib Sequence file: tem42 - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) Scores for sequence family classification (score includes all domains): Model Description Score E-value N -------- ----------- ----- ------- --- [no hits above thresholds] Parsed for domains: Model Domain seq-f seq-t hmm-f hmm-t score E-value -------- ------- ----- ----- ----- ----- ----- ------- [no hits above thresholds] Alignments of top-scoring domains: [no hits above thresholds] // ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ ~~~~~ L. Aravind's signalling DB IMPALA version 1.1 [20-December-1999] Reference: Alejandro A. Schaffer, Yuri I. Wolf, Chris P. Ponting, Eugene V. Koonin, L. Aravind, Stephen F. Altschul (1999), "IMPALA: Matching a Protein Sequence Against a Collection of "PSI-BLAST-Constructed Position-Specific Score Matrices", Bioinformatics 15:1000-1011. Query= tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) (181 letters) Searching..................................done Results from profile search Score E Sequences producing significant alignments: (bits) Value RGS Regulator of heterotrimeric G protein signalling (G-prot... 143 2e-37 PAS domain (Per-Arnt-Sim Domain (A ligand binding and dimeri... 21 1.1 CYCLIN Cyclin/TFIIB domain 20 1.9 BRIGHT BRIGHT domain (Alpha helical DNA binding domain) 20 3.2 POZ Pox virus Zinc finger domain (Also called BTB domain; a... 19 3.5 FKBP FK506 binding protein (Peptidyl prolyl isomerase) 19 3.8 ANK Ankyrin repeat 19 6.2 14-3-3 14-3-3 protein alpha Helical domain 18 6.7 PDE cyclic NMP phosphodiesterase domain 18 7.4 TBC Probable RAB-type GTPase GTP hydrolysis activating prote... 18 8.6 CATH Cathepsin like protease domain 18 9.8 >RGS Regulator of heterotrimeric G protein signalling (G-protein GTP hydrolysis activating protein) Length = 117 Score = 143 bits (358), Expect = 2e-37 Identities = 67/117 (57%), Positives = 96/117 (81%) Query: 64 SLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQT 123 SL+ L+ + GLA+FK+FLKSE+SEEN++FWI+CE+YKKIKSP+K++ KAK+IY EFI Sbjct: 1 SLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISV 60 Query: 124 EAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI 180 +A KEVN+D T++ T +N++EP+++ FD AQK+I LMEKDS RF++S FY +L+ Sbjct: 61 QATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLV 117 >PAS domain (Per-Arnt-Sim Domain (A ligand binding and dimerization domain)) Length = 117 Score = 21.0 bits (44), Expect = 1.1 Identities = 3/27 (11%), Positives = 9/27 (33%) Query: 111 EKAKQIYEEFIQTEAPKEVNIDHFTKD 137 + A ++ P + + K+ Sbjct: 47 KAAFADMWFTLKKGEPWSGIVKNRRKN 73 >CYCLIN Cyclin/TFIIB domain Length = 317 Score = 20.3 bits (42), Expect = 1.9 Identities = 8/61 (13%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Query: 99 DYKKIKSPAKMAEKAKQIYEEFIQTE---APKEVNIDHFTKDITMKNLVEPSLSSFDMAQ 155 + + A++ A + + P + +++T+ E L F Sbjct: 6 TFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVF 65 Query: 156 K 156 K Sbjct: 66 K 66 >BRIGHT BRIGHT domain (Alpha helical DNA binding domain) Length = 172 Score = 19.5 bits (40), Expect = 3.2 Identities = 10/32 (31%), Positives = 16/32 (49%), Gaps = 2/32 (6%) Query: 150 SFDMAQKRIHALMEKDSLPRFVRSEFYQELIK 181 SF+ K++ L E + P+ R EF +L Sbjct: 4 SFEEQFKQVRQLYEINDDPK--RKEFLDDLFS 33 >POZ Pox virus Zinc finger domain (Also called BTB domain; a protein-protein interaction domain) Length = 229 Score = 19.3 bits (39), Expect = 3.5 Identities = 8/66 (12%), Positives = 15/66 (22%), Gaps = 1/66 (1%) Query: 75 LASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHF 134 L + LK+ FS + + ++ I T I Sbjct: 46 LTRHDTMLKAMFSGRMEVLTDKEGWILIDRCGKHFGTILNYLRDDTI-TLPQNRQEIKEL 104 Query: 135 TKDITM 140 + Sbjct: 105 MAEAKY 110 >FKBP FK506 binding protein (Peptidyl prolyl isomerase) Length = 149 Score = 19.4 bits (40), Expect = 3.8 Identities = 8/51 (15%), Positives = 16/51 (30%) Query: 89 ENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDIT 139 +L + + ++ P A + +E+N D T D Sbjct: 76 PDLIQYFSRREFMDAGEPEIGAIMLFTAMDGSEMPGVIREINGDSITVDFN 126 >ANK Ankyrin repeat Length = 323 Score = 18.7 bits (38), Expect = 6.2 Identities = 8/39 (20%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Query: 35 DLVIPYNEKPEKPAKTQKTSLDEALQW--RDSLDKLLQN 71 D +I + + +T+ D A+Q R ++ +L Sbjct: 280 DRLIAAGARTDLKDDADRTAADIAVQLGHRQAIARLAPK 318 >14-3-3 14-3-3 protein alpha Helical domain Length = 270 Score = 18.4 bits (37), Expect = 6.7 Identities = 20/89 (22%), Positives = 32/89 (35%), Gaps = 9/89 (10%) Query: 44 PEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKI 103 P++ K + DEA+ LD L + +Y S L + +NL W + D + Sbjct: 190 PDRACYLAKQAFDEAIS---ELDSLSEESYK----DSTLIMQLLRDNLTLWTS--DAEYS 240 Query: 104 KSPAKMAEKAKQIYEEFIQTEAPKEVNID 132 + A + Q E E D Sbjct: 241 AAAAGGNTEGAQENAPSNAPEGEAEPKAD 269 >PDE cyclic NMP phosphodiesterase domain Length = 350 Score = 18.1 bits (36), Expect = 7.4 Identities = 13/41 (31%), Positives = 19/41 (45%), Gaps = 1/41 (2%) Query: 83 KSEFSEENLEFWIACEDYKKIKSPAKM-AEKAKQIYEEFIQ 122 K E + L F I C D I P + E + ++ +EF Q Sbjct: 203 KKEDRQMILNFLIKCGDISNIARPWHLNFEWSLRVSDEFFQ 243 >TBC Probable RAB-type GTPase GTP hydrolysis activating protein Length = 225 Score = 18.2 bits (37), Expect = 8.6 Identities = 4/25 (16%), Positives = 6/25 (24%) Query: 114 KQIYEEFIQTEAPKEVNIDHFTKDI 138 Q Y ++ P D Sbjct: 26 TQRYLALLKLGPPSTTIYQKIKNDT 50 >CATH Cathepsin like protease domain Length = 371 Score = 17.9 bits (36), Expect = 9.8 Identities = 6/25 (24%), Positives = 11/25 (44%) Query: 129 VNIDHFTKDITMKNLVEPSLSSFDM 153 V+ ++T D T N+ + M Sbjct: 208 VDPQYYTGDFTWVNVTRKAYWQIHM 232 Underlying Matrix: BLOSUM62 Number of sequences tested against query: 105 Number of sequences better than 10.0: 11 Number of calls to ALIGN: 11 Length of query: 181 Total length of test sequences: 20182 Effective length of test sequences: 16536.0 Effective search space size: 2414358.4 Initial X dropoff for ALIGN: 25.0 bits Y. Wolf's SCOP PSSM IMPALA version 1.1 [20-December-1999] Reference: Alejandro A. Schaffer, Yuri I. Wolf, Chris P. Ponting, Eugene V. Koonin, L. Aravind, Stephen F. Altschul (1999), "IMPALA: Matching a Protein Sequence Against a Collection of "PSI-BLAST-Constructed Position-Specific Score Matrices", Bioinformatics 15:1000-1011. Query= tem42gi|3914625|sp|O15539|RGS5_HUMAN REGULATOR OF G-PROTEIN SIGNALING 5 (RGS5) (181 letters) Searching.................................................done Results from profile search Score E Sequences producing significant alignments: (bits) Value gi|2688670 [455..688] beta-Lactamase/D-ala carboxypeptidase 24 1.4 gi|585004 [165..410] Creatinase/methionine aminopeptidase 24 1.7 gi|475909 [133..273] beta/alpha (TIM)-barrel 23 2.7 gi|2497339 [24..179] 4-helical cytokines 23 3.8 gi|1651961 [243..399] S-adenosylmethionine synthetase. MAT 23 4.0 gi|2407311 [3..100] MHC antigen-recognition domain 22 6.6 gi|2493481 [6..259] Ribonuclease H-like motif 22 6.7 gi|2648434 [141..374] beta/alpha (TIM)-barrel 22 7.1 gi|1351184 [55..290] ATP pyrophoshatases 22 8.0 gi|1420859 [36..611] Periplasmic binding protein-like II 22 8.1 gi|2494278 [153..355] Elongation factor Ts (EF-Ts), dimerisa... 22 8.9 gi|153548 [125..455] beta-Lactamase/D-ala carboxypeptidase 21 9.6 gi|1787711 [41..320] Periplasmic binding protein-like II 22 9.9 >gi|2688670 [455..688] beta-Lactamase/D-ala carboxypeptidase Length = 234 Score = 24.1 bits (52), Expect = 1.4 Identities = 15/112 (13%), Positives = 31/112 (27%), Gaps = 18/112 (16%) Query: 37 VIPYNEKPEKPAKTQKTSLDEALQWRDSL--DKLLQNNYGLASFKSFLKS--------EF 86 Y +AL ++ ++L G S S+ E Sbjct: 42 GEVYAPGNYGGKWRGNVLTRQALALSLNIPALRILD-RLGFDSAISYSSKLLGITDPKEI 100 Query: 87 SE-ENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKD 137 + + +A SP +MA + + + + E + +D Sbjct: 101 EKTFPKVYPLALGVIS--VSPIQMA----RAFAILGNSGSEIEPYGIRYIED 146 >gi|585004 [165..410] Creatinase/methionine aminopeptidase Length = 246 Score = 24.1 bits (52), Expect = 1.7 Identities = 8/77 (10%), Positives = 21/77 (26%), Gaps = 1/77 (1%) Query: 98 EDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKR 157 E+ IK+ A++A+ E I+ E + + ++ + + Sbjct: 6 EEIDLIKNGARIADIGGAAVVEAIREGV-PEYEVALHGTEAMVREIARTYPHAELRDTWI 64 Query: 158 IHALMEKDSLPRFVRSE 174 + Sbjct: 65 WFQSGINTDGAHNWATS 81 >gi|475909 [133..273] beta/alpha (TIM)-barrel Length = 141 Score = 23.2 bits (50), Expect = 2.7 Identities = 12/84 (14%), Positives = 25/84 (29%), Gaps = 17/84 (20%) Query: 16 AKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAK-----TQKTSLDEALQWRDSLDKLLQ 70 K+K+G LQ + Q+ + EA++W L K Sbjct: 2 WTRFKVKVGADLQD---DMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAK--- 55 Query: 71 NNYGLASFKSFLKSEFSEENLEFW 94 + ++ S +++ Sbjct: 56 --FKPLW----IEEPTSPDDILGH 73 >gi|2497339 [24..179] 4-helical cytokines Length = 156 Score = 23.0 bits (48), Expect = 3.8 Identities = 11/36 (30%), Positives = 20/36 (55%) Query: 60 QWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWI 95 Q +D LD +L + L FK +L + E ++F++ Sbjct: 33 QMKDQLDNMLLDGSLLEDFKGYLGCQALSEMIQFYL 68 >gi|1651961 [243..399] S-adenosylmethionine synthetase. MAT Length = 157 Score = 22.9 bits (49), Expect = 4.0 Identities = 16/62 (25%), Positives = 28/62 (44%), Gaps = 7/62 (11%) Query: 121 IQTEAPKEVNIDHF-TKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVR---SEFY 176 I P V ID F T + + L+E L++F++ R +++ +L FY Sbjct: 71 IGVARPVSVLIDTFGTGKVDEEKLLEVVLANFEL---RPAGIIQSLNLRNLPAERGGRFY 127 Query: 177 QE 178 Q+ Sbjct: 128 QD 129 >gi|2407311 [3..100] MHC antigen-recognition domain Length = 98 Score = 22.0 bits (47), Expect = 6.6 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Query: 40 YNEKPE-KPAKTQKTSLDEALQWRDSLDKLLQNNYGL 75 Y E+PE +P +QK L+ R ++D ++NYG+ Sbjct: 58 YLEQPEGRPWNSQKDILE---DERAAVDTYCRHNYGV 91 >gi|2493481 [6..259] Ribonuclease H-like motif Length = 254 Score = 22.1 bits (47), Expect = 6.7 Identities = 11/60 (18%), Positives = 22/60 (36%), Gaps = 12/60 (20%) Query: 10 HSCLERAKEIKIKLGILLQKPDSVG-----DLVIPYNEKPEKPAKTQKTSLDEALQWRDS 64 L + K K I +VG + ++ +N++ P + A+ W+D Sbjct: 51 SVQLATMQSAKNKAQIKSNNIAAVGITNQRETIVLWNKENGLP-------VYNAIVWQDQ 103 >gi|2648434 [141..374] beta/alpha (TIM)-barrel Length = 234 Score = 22.1 bits (47), Expect = 7.1 Identities = 12/100 (12%), Positives = 30/100 (30%), Gaps = 15/100 (15%) Query: 1 MCKGLAALPHSCLERAK------EIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTS 54 K + ++ K I L +L D+ I + S Sbjct: 3 TVKMVEKYAELGIDVVKLRFRRERINEDLEVLKAVAREFSDVKISVDANQAWSYTPPYWS 62 Query: 55 LDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFW 94 +A++ L+ + + L+ ++++E + Sbjct: 63 RKKAMKVAKELEN-----FEVLW----LEEPLWKDDVEGY 93 >gi|1351184 [55..290] ATP pyrophoshatases Length = 236 Score = 21.7 bits (46), Expect = 8.0 Identities = 6/67 (8%), Positives = 16/67 (22%), Gaps = 9/67 (13%) Query: 33 VGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLE 92 +G + + + D S+ + L + F K+ Sbjct: 70 IGGATGKVGDPSGRKTERDVMENDIRQSNVASISQQL---------QRFFKNGLEYYRNR 120 Query: 93 FWIACED 99 + + Sbjct: 121 CALTEDV 127 >gi|1420859 [36..611] Periplasmic binding protein-like II Length = 576 Score = 21.8 bits (46), Expect = 8.1 Identities = 18/105 (17%), Positives = 38/105 (36%), Gaps = 11/105 (10%) Query: 67 KLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKM------AEKAKQIYEEF 120 K L+N +F + +S+F E + D K + A EKAK + Sbjct: 327 KALRNMLVPPTFVTIGESDFGSEVEKEMAKLGDEWKDVNLADAQDGFYNPEKAKAEFA-- 384 Query: 121 IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKD 165 +A + + + T + + V+ + ++ + +E Sbjct: 385 ---KAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFKQSVEAS 426 >gi|2494278 [153..355] Elongation factor Ts (EF-Ts), dimerisation domain Length = 203 Score = 21.8 bits (46), Expect = 8.9 Identities = 10/92 (10%), Positives = 35/92 (37%), Gaps = 18/92 (19%) Query: 101 KKIKSPAKMAEKAKQIYEEFIQTEA-PKEV-------NIDHFTKDITMKN---------- 142 +I+ ++ K+ +E+ ++ + P+++ ++ F D T+ + Sbjct: 91 SRIELSDEVLAHQKKAFEDELKAQGKPEKIWDKIVPGKMERFIADNTLIDQRLTLLGQFY 150 Query: 143 LVEPSLSSFDMAQKRIHALMEKDSLPRFVRSE 174 +++ + + + + +VR E Sbjct: 151 VMDDKKTIAQVVADCSKEWNDDLKITEYVRFE 182 >gi|153548 [125..455] beta-Lactamase/D-ala carboxypeptidase Length = 331 Score = 21.4 bits (45), Expect = 9.6 Identities = 7/67 (10%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Query: 18 EIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKT--SLDEALQWRDSLDKLLQNNYGL 75 +++ I+ + + + +P + K S + ++ GL Sbjct: 221 GVRVAPRIVEGIYGNNDKGGLGDLIQQLQPTEMNKVNISDSDMSILHQGFYQVAHGTSGL 280 Query: 76 ASFKSFL 82 + ++F Sbjct: 281 TTGRAFS 287 >gi|1787711 [41..320] Periplasmic binding protein-like II Length = 280 Score = 21.5 bits (45), Expect = 9.9 Identities = 7/41 (17%), Positives = 13/41 (31%), Gaps = 1/41 (2%) Query: 105 SPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVE 145 +K +F + E VN+ M +L+ Sbjct: 5 IERGQTDKQYDWVTQF-EKETGCAVNVKTAATSDEMVSLMT 44 Underlying Matrix: BLOSUM62 Number of sequences tested against query: 1187 Number of sequences better than 10.0: 13 Number of calls to ALIGN: 13 Length of query: 181 Total length of test sequences: 256703 Effective length of test sequences: 207231.0 Effective search space size: 28848035.5 Initial X dropoff for ALIGN: 25.0 bits